An information system, method, and computer program product is provided for the centralized warning of existing or developing significant events and/or threats to affected users carrying a user warning and positioning device, while reporting the location of all user's carrying the user warning and positioning devices of the system to existing command and control systems. The present invention's future event warning capabilities permit those same affected users to be warned of impending events in...

An electrolyte for a metal-oxygen battery includes a non-aqueous solvent which is characterized in that the solubility of oxygen therein is at least 0.1150 cc O.sub.2/cc of solvent at STP. The electrolyte also includes an electrolyte salt dissolved in the solvent. The solvent may comprise a mixture of materials in which at least 50%, on a weight basis, of the materials have an oxygen solubility of at least 0.1760 cc O.sub.2/cc at STP. Also disclosed is a method for optimizing the composition of ...

In this application is described the expression and purification of a recombinant Plasmodium falciparum (FVO) MSP-1.sub.42. The method of the present invention produces a highly purified protein that retains folding and disulfide bridging of the native molecule. The recombinant MSP-1.sub.42 is useful as a diagnostic reagent, for use in antibody production, and as a vaccine.

A projectile may be used in a boat tail or base bleed configuration. The projectile includes a warhead casing having a nose end and a base end; a payload disposed in the warhead casing; a motor body attached to the base end of the warhead casing and having an igniter disposed therein; a base closure attached to the motor body, an exterior surface of the base closure being tapered to form a boat tail, the base closure and the motor body defining an interior volume; a propellant disposed in the in...

A monoclonal antibody to a consensus peptide of the formula: TABLE-US-00001 VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. (SEQ ID NO:1) The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO:2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

A muzzle brake has a rear end, a front end and a central axis. The muzzle brake includes a plurality of axially spaced turning vanes; each turning vane having an inside diameter that is substantially equal to or greater than an inside diameter of a rearmost turning vane, at least one turning vane having an inside diameter that is greater than the inside diameter of the rearmost turning vane; and each turning vane having a thickness that is substantially equal to or greater than a thickness of th...

An apparatus for retaining an object in a gun tube of a weapon system, the gun tube having a longitudinal axis, a chamber and a breech ring with an opening therein, the apparatus including a plunger that reciprocates in the opening in the breech ring and the chamber; a housing fixed in the opening in the breech ring, the housing holding the plunger; and means for reciprocating the plunger in the opening in the breech ring and the chamber. The object to be retained is propellant. The reciprocatin...

The Dual-Sliding Fin Lock Assembly provides a simple, cost-effective and secure locking mechanism that engages on the initial opening stroke of a fin of a flying object, using a minimal number of parts that are easy to manufacture. Two sliding locks, each having a protruding step, engage with two fin lugs each of which has a corresponding notch. When a step and a notch fit together, they form a contact plane which may be straight horizontal or inclined to ensure robust locking operation without ...

A micro-mirror optical tracking and ranging system comprises an optical transceiver having a Micro-Electro-Optical Mechanical System (MEOMS) micro-mirror beam steering system and an electronic control and operating system for processing electronic signals. An optical transceiver and MEOMS micro-mirror beam steering system comprises two oppositely installed micro-mirrors controlled so that they spin and tilt synchronously and project a laser beam out in a wide solid angle and interval in a substa...

Shaped charges that generate fan-like jets can produce slotted holes in rock formations. A shaped charge includes a case having on open front end, an external surface and a longitudinal axis, all transverse cross-sections of the case being bi-symmetric; an explosive material disposed in the case, the case including at least one opening extending from the external surface to the explosive material for initiation of the explosive material; and a liner disposed over the explosive material; wherein ...