Techniques are described for decreasing the number of errors when consensus decoding is used during speech recognition. A number of corrective rules are applied to confusion sets that are extracted during real-time speech recognition. The corrective rules are determined during training of the speech recognition system, which entails using many training confusion sets. A learning process is used that generates a number of possible rules, called template rules, that can be applied to the training ...

The present invention provides methods for enhanced detection of biological response profiles. In particular, the methods of this invention allow for the detection of biological response patterns, such as gene expression patterns, in response to different drug treatments. The methods of the invention also allow the determination of a "consensus profile" which describes a particular class or type of biological response. In certain embodiments the consensus profile may describe the biological resp...

Systems and methods that generate or provide overlap displays of multiple sets of data in a manner that advantageously simplifies trend visualization in large sets of data. A 2-dimensional occurrence count array is generated for a plurality of similar data sets. Each element in the array is a number of times a corresponding pair of data values x, y occurs in the plurality of N data sets, wherein each array element corresponds to a discrete interval of x and y data values. Once the array has been...

The present invention relates to a human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO:1); and AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDAT AKWWWKDAKWKMWRKTT (SEQ ID NO:4). A method for the control of initiation of mammalian DNA replication which comprises the steps of: a) inserting a consensus sequence coding for a sequence of the present inve...

Described are rapid and highly efficient procedures for the total synthesis of linear, double stranded DNA sequences in excess of about 200 base pairs in length, which sequences may comprise entire structural genes. Novel sequences are prepared from two or more DNA subunits provided with terminal regions comprising restriction endonuclease cleavage sites facilitating insertion of subunits into a selected vector for purposes of amplification during the course of the total assembly process. The to...

Image processing systems and methods for retrieving digital data stored in a plurality of contiguous data cells on photographic film. An image sensor samples the image data at a plurality of pixel positions in each of the data cells and generates grayscale image data that is processed into a one-dimensional stream of binary pixels. A data sampling system processes the binary pixels by first selecting those binary pixels that correspond to the data cell centers. Then, a digital output signal is c...

The present invention relates generally to a human interferon consensus gene useful for expression in eucaryotic systems and gene therapy. In particular, the present invention relates to treatment of cancer and cell proliferation disorders through use of viral vectors to deliver and express the human interferon consensus gene in the cells and/or tumors of a patient.

An interactive computer program generates a composite dot matrix representation of secondary structure elements from a set of functionally related oligonucleotides. The composite image facilitates visual detection of conserved secondary structure motifs with similar sequence sets. The complete pattern displaying all possible base pairings can be readily pruned with two progressive filters to provide the user with a simplified figure displaying only the most stable and conserved regions. Addition...

A method of sequential consensus region-directed amplification comprising, (a) amplifying a first segment of at least one target DNA in a DNA mixture, using a first and second oligonucleotide primer, each of which hybridizes to the target DNA, and a nucleic acid polymerase, under conditions in which DNA amplification is achieved, resulting in a first segment of double-stranded DNA; (b) amplifying a second segment of the first segment of double-stranded DNA, using a third and fourth oligonucleoti...

Methods for the retreatment, using a therapeutically effective amount of interferon consensus, of patients with HCV who exhibit serum ALT values above the upper limit of normal after previous treatment with interferon.