The present invention encompasses methods for preventing and treating multiple sclerosis by administering to patients in need thereof a therapeutically effective amount of IFN-con in combination with IL-1ra.

The present invention relates to methods for producing a polypeptide, comprising: (a) cultivating a fungal host cell in a medium conducive for the production of the polypeptide, wherein the fungal host cell comprises a first nucleic acid sequence encoding the polypeptide operably linked to a second nucleic acid sequence comprising a consensus translational initiator sequence foreign to the nucleic acid sequence; and (b) isolating the polypeptide from the cultivation medium. The present invention...

In a specific embodiment, this invention includes a method for determining an accurate, consensus pharmacophore structure shared by compounds that bind selectively to a target molecule. Optionally, the method begins with screening a diversity library against the target molecule of interest to pick the selectively binding members. Next the structure of the selected members is examined and a candidate pharmacophore responsible for the binding to the target molecule is determined. Next, preferably ...

The invention relates to compositions and methods for targeting sequence modifications in one or more genes of a related family of genes using enhanced homologous recombination techniques. These techniques may be used to create animal or plant models of disease as well as to identify new targets for drug or pathogen screening.

A rapid method for generating a set of discrete DNA amplification products characteristic of a genome as a "fingerprint" for typing the genome comprises the steps of: forming a polymerase chain reaction (PCR) admixture by combining, in a PCR buffer, genomic DNA and at least one structural RNA consensus primer, and subjecting the PCR admixture to a plurality of PCR thermocycles to produce a plurality of DNA segments, thereby forming a set of discrete DNA amplification products. The method is know...

Methods for the treatment of cell proliferation disorders, viral infections, and other conditions without causing significant side effects normally associated with interferon therapy, involving administering to a patient in need thereof a therapeutically effective amount of consensus human leukocyte interferon are disclosed. Also disclosed are pharmaceutical compositions of consensus human leukocyte interferon.

The present teachings disclose a method for evaluation of a polynucleotide sequence using a consensus-based analysis approach. The sequence analysis method utilizes quality values for a plurality of aligned sequence fragments to identify consensus basecalls and calculate associated consensus quality values. The disclosed method is applicable to resolution of single nucleotide polymorphisms, mixed-based sequences, heterozygous allelic variants, and heterogeneous polynucleotide samples.

The present invention provides nucleic acids encoding consensus hemagglutinin and consensus fusion polypeptides which contain at least one amino acid substitution relative to the Moraten vaccine strain that is found in at least one strain of wild-type measles virus. Nucleic acid reagents useful for detecting and differentiating wild-type measles strains by polymerase chain reaction and a method utilizing the same are provided. Recombinant vectors comprising nucleic acids encoding the consensus h...

A data processing system having execution units for executing instruction sequences determines at least two conditionals in accordance with the instructions and sets respective flags according to the determined conditionals. These flags are stored and later retrieved sequentially and the execution unit executes selected instructions of the instruction sequence according to the sequentially retrieved mask flags. These masked flags may be stored sequentially in a stack for sequential retrieval at ...

This invention relates to amino acid sequences from within a consensus peptide of the formula: TABLE-US-00001 VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1) Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQ...